2 Chronicles 22:6

English Darby 1890 : Public Domain

2 Chronicles 22:6 (English Darby 1890 : Public Domain) — "And he returned to be healed in Jizreel because of the wounds that were given him at Ramah, when he "
2 Chronicles 22:6 — English Darby 1890 : Public Domain

What Does This Mean?

This verse talks about Jehoram, the king of Judah, who went to Jezreel to heal from wounds he received in battle with Hazael of Syria. Azariah, another son of Jehoram, visited him because he was sick.

Explained for Children

Imagine if you got hurt playing soccer and had to go to the doctor to get better. That's what happened to Jehoram. He got hurt in a fight and went to Jezreel to heal. His brother Azariah came to see him because he was sick.

Historical Background

The Book of 2 Chronicles was written by an unknown author, possibly a priest or a scribe, around the 4th century BC. It was written for the people of Judah to remind them of their history and to encourage them to follow God's laws. The cultural setting is that of the divided kingdom, with frequent conflicts and alliances between Israel and Judah.

Living It Out Today

When we get hurt, physically or emotionally, it's important to seek help and support from others. Just as Azariah went to see Jehoram, we should reach out to friends and family when we're going through difficult times.

Topics

healingconflictfamilyleadershipvisitationsickness

Related Verses

2 Kings 8:28-292 Kings 9:14-151 Kings 22:29-302 Chronicles 21:18-192 Chronicles 22:1

Frequently Asked Questions

Who are the key figures in 2 Chronicles 22:6?
The key figures are Jehoram, king of Judah, who was wounded, and Azariah, another son of Jehoram, who visited Jehoram at Jezreel.
What led to Jehoram's injury?
Jehoram was injured in a battle with Hazael, the king of Syria, at Ramah.
Why did Azariah go to see Jehoram?
Azariah went to Jezreel to visit Jehoram because he was sick, showing the importance of family support during difficult times.
What can we learn from this verse about leadership?
Leadership involves recognizing when to seek help and support, as Jehoram did by going to Jezreel to be healed, and the importance of family and community support, as shown by Azariah's visit.
Compare 2 Chronicles 22:6 →