2 Chronicles 3:1

English Darby 1890 : Public Domain

2 Chronicles 3:1 (English Darby 1890 : Public Domain) — "And Solomon began to build the house of Jehovah at Jerusalem on mount Moriah, where he appeared to D"
2 Chronicles 3:1 — English Darby 1890 : Public Domain

What Does This Mean?

This verse tells us that Solomon started building the temple of the Lord in Jerusalem on Mount Moriah. This place was special because it was where God appeared to David, Solomon's father, and where David had already prepared a site on Ornan's threshing floor.

Explained for Children

Imagine you're building a really big dollhouse for your favorite toy. Solomon was doing something similar but much bigger and for God. He was building a special house for God in a place where God had already shown Himself to Solomon's dad, David.

Historical Background

The book of 2 Chronicles was written by an unknown author, possibly a priest or prophet, after the Babylonian exile, around 300 BCE. The audience was likely the returned exiles who needed to be reminded of their history and the importance of the temple for their religious life.

Living It Out Today

Today, just as Solomon chose a special place to build the temple, we can choose to make our homes and hearts special places for God. We can do this by setting aside specific times and spaces for prayer and reflection, making our lives a reflection of God’s presence.

Topics

templefaithleadershipprayersacrificeworship

Related Verses

2 Samuel 24:18-251 Kings 6:1-21 Chronicles 21:18-281 Kings 8:1-11John 2:13-22

Frequently Asked Questions

What was the significance of Mount Moriah?
Mount Moriah was significant because it was the place where God had previously appeared to David, indicating a special divine presence there. It also became the site where Solomon built the temple.
How does 2 Chronicles 3:1 relate to 2 Samuel?
2 Samuel 24 provides the background for why David chose the site on Mount Moriah, which later became the location where Solomon began building the temple.
What does the appearance of God to David mean in 2 Chronicles 3:1?
The appearance of God to David signifies the divine approval of the site for the temple, which was a key factor in Solomon's decision to build there.
How does this verse help us understand the relationship between Solomon and David?
This verse shows the continuity of their leadership, with Solomon following through on the plans and visions given to David by God, solidifying their shared purpose in serving God.
Compare 2 Chronicles 3:1 →