Esther 1:10

English Darby 1890 : Public Domain

Esther 1:10 (English Darby 1890 : Public Domain) — "On the seventh day, when the king's heart was merry with wine, he commanded Mehuman, Biztha, Harbona"
Esther 1:10 — English Darby 1890 : Public Domain

What Does This Mean?

In Esther 1:10, King Ahasuerus, feeling merry from wine on the seventh day of his feast, called for his seven chamberlains. The verse highlights the king's desire to command his servants during a celebratory event.

Explained for Children

Imagine you're at a big party, and you're really happy because you've been eating yummy food and drinking juice. Now, you want to ask your friends to do something for you. That's what King Ahasuerus did, but he was asking his special helpers to do something for him.

Historical Background

The Book of Esther was likely written in the 5th century BCE, after the Babylonian exile. It was written for the Jewish people to remind them of their deliverance and to establish the origin of the Purim festival. The cultural setting involves a Persian king and his court, where grand feasts and the use of chamberlains were common.

Living It Out Today

In today's context, this verse can be applied to our daily lives by considering how we behave when we are in a good mood. It's important to use our positive emotions wisely and not let them cloud our judgment in decision-making.

Topics

leadershipwinefeastsservantsmerryjudgment

Related Verses

1 Samuel 25:36Luke 12:42-481 Corinthians 10:31Proverbs 16:32Esther 5:4

Frequently Asked Questions

Why did King Ahasuerus call his chamberlains?
King Ahasuerus called his chamberlains because he was in a merry mood and likely wanted to issue a command or request something from them.
Who were the seven chamberlains?
The seven chamberlains were Mehuman, Biztha, Harbona, Bigtha, Abagtha, Zethar, and Carcas, who served directly in the presence of King Ahasuerus.
What was the cultural significance of chamberlains in the Persian court?
Chamberlains were trusted servants who had close access to the king and played important roles in executing the king's commands and managing court affairs.
How does this verse set the stage for the rest of the book of Esther?
This verse introduces the setting of a grand feast and the king's reliance on his servants, which later becomes crucial in Esther's interactions with the king and her role in saving her people.
Compare Esther 1:10 →