1 Samuel 17:25

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

The men of Israel are talking about a man named Goliath who has come to challenge them. They say that whoever kills Goliath will be rewarded with riches, a royal marriage, and honor for their family. This shows the desperation and hope of the Israelites in that moment.

Explicado para crianças

Imagine if there was a big, scary bully at school who was challenging everyone to a fight. The principal says that whoever beats the bully will get a special prize, like a shiny trophy and a free dinner at the best restaurant. That's kind of what's happening here, but with a whole country's worth of people!

Contexto histórico

1 Samuel was written by various authors, possibly including Samuel himself, Nathan, and Gad. It was written around 1000 BC. This passage is addressing the Israelites, detailing their fear and desperation in the face of the Philistine threat. The cultural setting is one of conflict and the hope of a hero rising up to save the day.

Aplicação para hoje

Imagine a small business facing a big competitor. The owner offers a significant reward for an innovative solution to outcompete the rival. This verse teaches us about the power of incentives and the hope they can bring in times of adversity.

Temas

faithhopeadversityrewardleadershipfamily

Versículos relacionados

1 Samuel 17:40Judges 6:122 Samuel 21:191 Corinthians 9:7Ephesians 6:10

Perguntas frequentes

Why was Goliath coming to 'defy' Israel?
Goliath was challenging Israel to a fight, essentially saying they were weak and not worthy of their land, which was a direct challenge to their faith and God's promise.
What did the reward for killing Goliath include?
The reward included great riches, the king's daughter in marriage, and freedom for the killer's family from taxes or military service in Israel.
How does this verse show the desperation of the Israelites?
The offer of such lavish rewards for killing Goliath shows how desperate the Israelites were for a solution to their conflict with the Philistines.
What can we learn about leadership from this verse?
Leadership can inspire and motivate people by offering incentives and recognizing those who step up to overcome challenges and protect their community.
Comparar 1 Samuel 17:25 →