2 Chronicles 29:14

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

This verse lists some of the descendants of Heman and Jeduthun, who were important musicians in the temple. It mentions Jehiel, Shimei, Shemaiah, and Uzziel. This list helps us understand the roles and family lines of the temple musicians.

Explicado para crianças

Imagine you have a family of friends who are really good at singing and playing music. This verse is like a guest list for a big concert, saying who is going to perform. It names some of the best singers and musicians who would play in the temple, just like you might name your best friends to play in a band with you.

Contexto histórico

2 Chronicles was written by an unknown author, likely after the Babylonian exile, around the 4th century BCE. It was intended for the returning Israelites to remind them of their history and the importance of worshiping in the temple. The text reflects the cultural setting where music and praise were central to temple worship.

Aplicação para hoje

Today, we can apply this verse by recognizing the importance of using our talents to glorify God, whether in music or any other skill. Just as these musicians played a crucial role in temple worship, we can use our abilities to serve and praise God in our communities.

Temas

worshipmusiciansfamilyservicetemplesinging

Versículos relacionados

1 Chronicles 6:331 Chronicles 15:171 Chronicles 25:1Psalm 88:1Ephesians 5:19

Perguntas frequentes

Why are these specific names mentioned in 2 Chronicles 29:14?
These names are mentioned to highlight the specific individuals responsible for music and praise in the temple worship, emphasizing the structured and important role of music in religious practices.
What role did Heman and Jeduthun play in the temple?
Heman and Jeduthun were chief musicians and leaders in the temple worship. They were responsible for organizing the music and leading the praise and worship services.
How can we apply the idea of using our talents to glorify God in our daily lives?
We can apply this idea by finding ways to use our skills and abilities to serve others and bring glory to God. Whether through music, art, teaching, or any other talent, we can use these to praise God and help others.
Why is the family lineage important in this context?
The family lineage is important because it helps trace the roles and responsibilities passed down through generations within the temple worship system, highlighting the continuity and importance of these roles in Jewish religious life.
Comparar 2 Chronicles 29:14 →