Numbers 7:3

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

This verse from Numbers describes how the princes brought offerings to God for the tabernacle. They provided six wagons and twelve oxen, with each wagon shared by two princes and each prince providing an ox.

Explicado para crianças

Imagine you and your friend bringing a toy car and a toy horse each to share for a big playhouse. That's what these princes did, but with real wagons and oxen for a special tent where God's presence lived.

Contexto histórico

Numbers was written by Moses around 1400 BC, recounting the Israelites' journey from Egypt to the Promised Land. This verse reflects the tribes' contributions to set up the tabernacle, their mobile place of worship in the desert.

Aplicação para hoje

Today, we might think of this as a community project where everyone contributes something for a shared goal. Like a group of neighbors pooling resources to build a park.

Temas

offeringscommunityserviceleadershipsacrificeworship

Versículos relacionados

Exodus 25:1-91 Chronicles 29:1-9Luke 21:1-4Hebrews 13:161 Corinthians 9:13-14

Perguntas frequentes

Why did each prince bring an ox?
The ox was a valuable animal, symbolizing their commitment and resourcefulness in supporting the tabernacle's needs.
How many princes were involved in this offering?
Since each of the six wagons was shared by two princes, this indicates twelve princes contributed to the offering.
What was the purpose of the wagons and oxen?
The wagons and oxen were likely used for transporting goods and materials needed for the tabernacle's maintenance and operation.
Is there a lesson about sharing in this verse?
Yes, this verse demonstrates the importance of sharing resources for a communal goal, reflecting the unity and collaboration among the tribes.
Comparar Numbers 7:3 →