2 Samuel 6:22

English Darby 1890 : Public Domain

2 Samuel 6:22 (English Darby 1890 : Public Domain) — "And I will make myself yet more vile than thus, and will be base in mine own sight; and of the handm"
2 Samuel 6:22 — English Darby 1890 : Public Domain

What Does This Mean?

David is speaking in this verse, saying that he will continue to humble himself even further. He acknowledges his own unworthiness and mentions that even the maidservants will honor him. This reflects his deep sense of humility and recognition of God's grace.

Explained for Children

Imagine if you had a really big cake, and everyone was saying how great you were for having it. But instead of feeling proud, you said, 'I'll be even more humble than this, and I think I'm not so great.' David feels this way about himself, even though he's the king. He thinks he's not as important as God wants him to be.

Historical Background

This verse is part of the Books of Samuel, written by prophets around 960-550 BCE. The audience was the Israelites, and the cultural setting was a time of kingship and divine governance, reflecting the relationship between human leaders and God's will.

Living It Out Today

Consider a situation where you've achieved something significant at work, but instead of boasting, you express how much you value your team and how they've helped you. This mirrors David's humility, emphasizing the importance of recognizing our reliance on others and God's grace.

Topics

humilityfaithgraceleadershipself-worthdivine governance

Related Verses

1 Samuel 24:10Psalms 131:1James 4:101 Peter 5:5Luke 14:11

Frequently Asked Questions

Who is speaking in 2 Samuel 6:22?
David, the King of Israel, is speaking in this verse.
What does it mean to be 'base in mine own sight'?
It means to see oneself as unworthy or humble, recognizing one's limitations and acknowledging a need for divine grace.
Why does David mention maidservants?
David is emphasizing his humility by stating that even those of lower status, like maidservants, will honor him, highlighting his low self-perception.
How does 2 Samuel 6:22 relate to leadership?
This verse shows that true leadership involves humility and recognizing the contributions of others, rather than seeking personal glory.
Compare 2 Samuel 6:22 →