Luke 18:29

Spanish Version Is Called = Free Bible Version or (Versión Biblia Libre = VBL) - Public Domain - http://www.freebibleversion.org/ - Copyright © 2018 Jonathan Gallagher y Shelly Barrios de Avila

¿Qué significa esto?

Jesus is speaking here and tells his followers that no one who has given up their house, family members or loved ones for the kingdom of God will be left out in the end. The key message is about sacrifice and reward.

Explicado para niños

Imagine you have to give up your favorite toy to help someone else. Jesus says if you do that for him, he won't forget what you did and will take care of you later. It's like trading a small thing now for something much bigger later.

Contexto histórico

This verse is from the Gospel of Luke, written by Luke around AD 80-100 to Greek-speaking Christians. The cultural context was that sacrifices for religious beliefs were common but not always valued in society.

Aplicación para hoy

Think about a time you had to choose between staying with family and pursuing your faith or career. This verse reassures us that God remembers our sacrifices and will reward them.

Temas

faithrewardfamilysacrificekingdom of Godhope

Versículos relacionados

Matthew 19:27Mark 10:28Psalm 34:9Romans 8:18Hebrews 11:6

Lecturas recomendadas

Preguntas frecuentes

Does leaving family mean we must abandon them completely?
No, it doesn't mean abandonment. It means prioritizing faith over worldly ties when necessary.
What kind of rewards does God offer for these sacrifices?
God's rewards are often spiritual and eternal, like peace in the kingdom of God.
How do we know if our sacrifice is for the kingdom of God?
If your actions align with God’s will and serve others or spread faith, it may be considered a sacrifice for the kingdom.
What does this verse teach about making tough decisions in life?
It teaches that when we make difficult choices based on faith, God values them highly and promises future rewards.
Comparar Luke 18:29 →