Matthew 9:30

Spanish Version Is Called = Free Bible Version or (Versión Biblia Libre = VBL) - Public Domain - http://www.freebibleversion.org/ - Copyright © 2018 Jonathan Gallagher y Shelly Barrios de Avila

¿Qué significa esto?

In this verse, after Jesus heals two blind men by opening their eyes, he tells them not to tell anyone about it. This shows that Jesus often preferred quiet healing and didn't want the news of his miracles spread widely.

Explicado para niños

Imagine you have a super secret toy that only your best friend knows about. Jesus gave these two people something amazing - the ability to see! But he told them, 'Don't tell anyone about it,' just like keeping a special surprise to yourself.

Contexto histórico

This verse is part of the Gospel of Matthew, written around 80-90 AD by an unknown author. The audience was likely early Jewish Christians who needed to understand Jesus' teachings and actions in light of their religious heritage and the growing Christian community.

Aplicación para hoy

Consider a scenario where you receive a personal benefit or gift at work that makes you stand out. Instead of bragging about it, you choose to let your skills speak for themselves quietly. This mirrors Jesus’ request to not make his miracles public knowledge.

Temas

faith healingprivacydiscipleshipmiraclesquiet leadershiphumility

Versículos relacionados

Mark 8:26Luke 9:21John 7:3-4Matthew 12:15-21Acts 10:38

Lecturas recomendadas

Preguntas frecuentes

Why did Jesus tell them not to spread it?
Jesus often wanted his miracles to be witnessed quietly, to focus on faith rather than sensationalism. This helped keep the attention on his teachings and the nature of his ministry.
Can you give an example of a quiet leadership today like Jesus' request?
A CEO who chooses to lead by example without constant self-promotion, focusing instead on team success, mirrors this quiet yet powerful approach similar to Jesus’ instruction.
How do we know this verse is historically accurate?
The Gospel of Matthew was written early in the first century and reflects the traditions and teachings that were circulating among early Christians. Scholars consider it a reliable historical source.
What does this teach us about privacy in miracles or good deeds?
It teaches us to be humble when receiving blessings, allowing our actions and character to speak for themselves without the need for public recognition.
Comparar Matthew 9:30 →