2 Chronicles 18:17

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

This verse shows King Ahab talking to King Jehoshaphat about a prophet named Micaiah. Ahab tells Jehoshaphat that he knew Micaiah would not say anything good about him, but instead would say something bad. This highlights Ahab's skepticism towards Micaiah's prophecies.

Explicado para crianças

Imagine you're playing a game with your friend, and you think another friend might tell you that you'll lose. That's kind of like what's happening here. King Ahab is telling his friend King Jehoshaphat that he thought the prophet Micaiah wouldn't say anything nice about him, but would instead say something not so good.

Contexto histórico

This verse is from the Book of 2 Chronicles, which was written around the 4th century BCE by unknown authors. It was written for the people of Judah to remind them of their history and the importance of following God. The verse reflects the political and religious tensions of the time between the kings of Israel and Judah.

Aplicação para hoje

In a modern context, this verse can remind us to be cautious of our expectations when seeking advice or prophecy. Just like Ahab expected Micaiah to give him bad news, we should prepare ourselves for honest and sometimes difficult feedback in our personal and professional lives.

Temas

prophecyleadershipskepticismadviceexpectationshonesty

Versículos relacionados

1 Kings 22:18Jeremiah 28:151 Samuel 15:18John 3:192 Timothy 4:3

Perguntas frequentes

What is the main message of 2 Chronicles 18:17?
The main message is about Ahab's skepticism towards Micaiah's prophecies, showing that Ahab expected negative news rather than positive.
How does this verse relate to the story of Ahab and Jehoshaphat?
It shows the relationship between Ahab and Jehoshaphat, where Ahab is sharing his doubts with Jehoshaphat about a prophet named Micaiah.
What can we learn from Ahab's reaction?
Ahab's reaction teaches us to be prepared for honesty, even if it's difficult to hear, and to not always expect positive outcomes from advice or prophecies.
How does this verse fit into the broader theme of prophecy in the Bible?
This verse is part of a larger theme where prophecies often carry warnings and truths that are not always easy to accept, but are crucial for the well-being of the community or individuals.
Comparar 2 Chronicles 18:17 →