2 Chronicles 2:6

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

The verse comes from King Solomon, who recognizes that God is too great to be contained in a building. He questions how he could build a house for God, suggesting instead that the real purpose of the temple would be for sacrifices to God.

Explicado para crianças

Imagine you have a tiny dollhouse, but you want to put the whole world inside it. That's impossible, right? King Solomon felt this way about building a house for God, who is so big and amazing that even the sky can't hold him all! Instead, Solomon thought the real purpose of the house would be to have a special place to offer sacrifices to God.

Contexto histórico

2 Chronicles 2:6 was written by a chronicler, likely during the post-exilic period, to an audience returning from Babylonian exile. It reflects the idea that God is incomprehensibly vast and that Solomon's grand building project was not to contain God, but to offer a place for worship and sacrifice.

Aplicação para hoje

Today, this verse can remind us that our efforts to honor God, like building a church or a community center, are not about containing God but about providing a space for people to gather and offer their praise and prayers. Think about how your efforts to honor God are more about service and community than about grand structures.

Temas

faithworshipprayersacrificetempledivinity

Versículos relacionados

1 Kings 8:27Isaiah 66:1Acts 7:481 Corinthians 3:9Hebrews 9:14

Perguntas frequentes

Who is speaking in 2 Chronicles 2:6?
King Solomon is speaking, reflecting on the nature of God and the purpose of building a temple.
What does Solomon say about building a house for God?
Solomon expresses that God is too great to be contained in any building, suggesting that sacrifices are the true purpose of the temple.
Why does Solomon think God cannot be contained in a house?
Solomon understands that God is infinite and beyond physical containment, emphasizing God's omnipresence and greatness.
How does this verse relate to modern church buildings?
This verse reminds us that the purpose of church buildings is not to contain God but to provide a space for community worship and service.
Comparar 2 Chronicles 2:6 →