Psalms 122:8

Portuguese Almeida 1628 (Public Domain)

O que isso significa?

This verse is about the speaker wishing peace for a place or a person because of the speaker's close relationships with those who live there. The key message is the desire for peace among family and friends.

Explicado para crianças

Imagine your best friend's house is like a big warm hug. You really want your friend and everyone in the house to be happy and safe. This verse is like saying a big 'I hope you all have a great day!' to your friend's whole family.

Contexto histórico

Psalms 122 was written by David, likely during a time of national unity in Jerusalem. It reflects on the unity and peace among Israelites, particularly those who travel to Jerusalem for religious festivals.

Aplicação para hoje

Think about a time when you were visiting family or friends, and you felt the need to wish them well. This verse reminds us to prioritize peace and harmony in our relationships with loved ones, especially when we are away from them.

Temas

peacefamilyfriendshipwell-wishingcommunitylove

Versículos relacionados

Psalms 125:5Psalms 128:6Psalms 133:1Romans 14:191 Peter 3:11

Perguntas frequentes

Who is the speaker in Psalm 122:8?
The speaker is David, who is expressing his desire for peace among his fellow Israelites, especially those who are his brothers and companions.
What does 'Peace be within thee' mean in Psalm 122:8?
It means wishing well and peace to the place or people David is referring to, emphasizing his hope for their well-being and harmony.
How does Psalm 122:8 relate to unity?
This verse highlights the importance of unity and peace among family and friends, reflecting the broader theme of community and harmony in the Psalms.
Can Psalm 122:8 be applied in a modern workplace?
Yes, it can be applied by wishing peace and harmony among colleagues, fostering a supportive and cooperative work environment.
Comparar Psalms 122:8 →